| Edit |   |
|---|
| Antigenic Specificity | Matrilin-1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Matrilin-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Matrilin-1. This antibody reacts with human. The Matrilin-1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to MATN1(matrilin 1, cartilage matrix protein) The peptide sequence was selected from the middle region of MATN1 (NP_002370). Peptide sequence KYLIDNSFTVSSGARPGAQKVGIVFTDGRSQDYINDAAKKAKDLGFKMFA. |
|---|
| Other Names | cartilage matrix protein, matrilin 1, cartilage matrix protein |
|---|
| Gene, Accession # | MATN1, Gene ID: 4146, Accession: P21941, SwissProt: P21941 |
|---|
| Catalog # | NBP1-70634-20ul |
|---|
| Price | |
|---|
| Order / More Info | Matrilin-1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|