| Edit |   |
| Antigenic Specificity | CAB39 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CAB39 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CAB39. This antibody reacts with human. The CAB39 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CAB39(calcium binding protein 39) The peptide sequence was selected from the middle region of CAB39. Peptide sequence KTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRP. |
| Other Names | calcium binding protein 39, calcium-binding protein 39, FLJ22682, MO25CGI-66, Protein Mo25 |
| Gene, Accession # | CAB39, Gene ID: 51719, Accession: Q9Y376, SwissProt: Q9Y376 |
| Catalog # | NBP1-55393 |
| Price | |
| Order / More Info | CAB39 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |