| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EBAG9/RCAS1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EBAG9/RCAS1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EBAG9/RCAS1. This antibody reacts with human. The EBAG9/RCAS1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human EBAG9/RCAS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKL |
|---|
| Other Names | Cancer-associated surface antigen RCAS1, EB9cancer associated surface antigen, estrogen receptor binding site associated, antigen, 9, Estrogen receptor-binding fragment-associated gene 9 protein, RCAS1PDAF, receptor-binding cancer antigen expressed on SiSo cells |
|---|
| Gene, Accession # | EBAG9, Gene ID: 9166 |
|---|
| Catalog # | NBP1-84922 |
|---|
| Price | |
|---|
| Order / More Info | EBAG9/RCAS1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|