| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MIOX |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MIOX Antibody from Novus Biologicals is a rabbit polyclonal antibody to MIOX. This antibody reacts with human. The MIOX Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MIOX antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLDRVLMSWGHDEYMYQVMKFNKFSL |
|---|
| Other Names | aldehyde reductase (aldose reductase) like 6, Aldehyde reductase-like 6, ALDRL6, inositol oxygenase, Kidney-specific protein 32, KSP32, MGC90217, MI oxygenase, myo-inositol oxygenaseEC 1.13.99.1, Renal-specific oxidoreductase, RSOR |
|---|
| Gene, Accession # | MIOX, Gene ID: 55586, Accession: Q9UGB7, SwissProt: Q9UGB7 |
|---|
| Catalog # | NBP2-31976 |
|---|
| Price | |
|---|
| Order / More Info | MIOX Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|