| 产品详情 |
| Edit |   |
| Antigenic Specificity | SMAD6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SMAD6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SMAD6. This antibody reacts with human. The SMAD6 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human SMAD6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PRPMSEPGAGAGSSLLDVAEPGGPGWLPESDCETVTCCLF |
| Other Names | hSMAD6, HsT17432, MAD homolog 6, MADH6SMAD, mothers against DPP homolog 6 (Drosophila), MADH7, mothers against decapentaplegic homolog 6, Mothers against decapentaplegic, drosophila, homolog of, 6, Mothers against DPP homolog 6, SMAD 6, SMAD family member 6MAD, mothers against decapentaplegic homolog 6 (Drosophila), SMAD, mothers against DPP homolog 6, Smad6 |
| Gene, Accession # | SMAD6, Gene ID: 4091 |
| Catalog # | NBP2-56758 |
| Price | |
| Order / More Info | SMAD6 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|