| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLURP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, Chinese hamster |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLURP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLURP1. This antibody reacts with human, chinese hamster. The SLURP1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, chinese hamster SLURP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCV ATDPDSIGAAHLIFCCFRDLCN |
|---|
| Other Names | ANUPARS(component B)-81/S, ARS component B, ArsB, ARSlymphocyte antigen 6-like secreted, LY6LS, MDMsecreted Ly-6/uPAR-related protein 1, neoplastic urinary protein, secreted LY6/PLAUR domain containing 1, secreted Ly6/uPAR related protein 1, SLURP-1 |
|---|
| Gene, Accession # | SLURP1, Gene ID: 57152 |
|---|
| Catalog # | NBP2-13351 |
|---|
| Price | |
|---|
| Order / More Info | SLURP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 27034464 |
|---|
| 产品资料 |
|
|