| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | UGT2B15 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UGT2B15 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UGT2B15. This antibody reacts with human. The UGT2B15 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to UGT2B15(UDP glucuronosyltransferase 2 family, polypeptide B15) The peptide sequence was selected from the N terminal of UGT2B15. Peptide sequence IKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYY. |
|---|
| Other Names | EC 2.4.1, EC 2.4.1.17, HLUG4, UDP glucuronosyltransferase 2 family, polypeptide B15, UDP glycosyltransferase 2 family, polypeptide B15, UDP glycosyltransferase 2B15, UDP-glucuronosyltransferase 2B15, UDP-glucuronosyltransferase 2B8, UDP-glucuronosyltransferase UGT2B15, UDP-glucuronyltransferase, family 2, beta-15, UDPGT 2B15, UDPGT 2B8, UDPGTh-3, UDPGTH3, UGT2B8UDPGT2B15 |
|---|
| Gene, Accession # | UGT2B15, Gene ID: 7366, Accession: P54855, SwissProt: P54855 |
|---|
| Catalog # | NBP1-69700 |
|---|
| Price | |
|---|
| Order / More Info | UGT2B15 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|