| 产品详情 |
| Edit |   |
| Antigenic Specificity | UHRF1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF, Fixation/Permeabilization: PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The UHRF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UHRF1. This antibody reacts with human. The UHRF1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VFKIERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQD PDKQLMCDECDMAFHIYCLDPPLSSVPSEDE |
| Other Names | E3 ubiquitin-protein ligase UHRF1, EC 6.3.2, EC 6.3.2.-, FLJ21925, hNP95, huNp95, ICBP90NP95, Inverted CCAAT box-binding protein of 90 kDa, Np95, Nuclear protein 95, Nuclear zinc finger protein Np95, RING finger protein 106, RNF106MGC138707, Transcription factor ICBP90, Ubiquitin-like PHD and RING finger domain-containing protein 1, ubiquitin-like with PHD and ring finger domains 1, ubiquitin-like, containing PHD and RING finger domains, 1, Ubiquitin-like-containing PHD and RING finger domains protein 1 |
| Gene, Accession # | UHRF1, Gene ID: 29128 |
| Catalog # | NBP2-13504 |
| Price | |
| Order / More Info | UHRF1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|