| Edit |   |
|---|
| Antigenic Specificity | WDR73 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The WDR73 Antibody from Novus Biologicals is a rabbit polyclonal antibody to WDR73. This antibody reacts with human. The WDR73 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human WDR73The immunogen for this antibody is WDR73. Peptide sequence VVDLESRKTTYTSDVSDSEELSSLQVLDADTFAFCCASGRLGLVDTRQKW. |
|---|
| Other Names | FLJ00296 protein, FLJ14888, HSPC264, WD repeat domain 73, WD repeat-containing protein 73 |
|---|
| Gene, Accession # | WDR73, Gene ID: 84942, Accession: NP_116245, SwissProt: NP_116245 |
|---|
| Catalog # | NBP1-79863 |
|---|
| Price | |
|---|
| Order / More Info | WDR73 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|