| Edit |   |
| Antigenic Specificity | C17orf64 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The C17orf64 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C17orf64. This antibody reacts with human. The C17orf64 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to C17ORF64 The peptide sequence was selected from the middle region of C17ORF64. Peptide sequence NMQTPGQGSPLPGQPRSQDHVKKDSLRELSQKPKLKRKRIKEAPETPETE. |
| Other Names | chromosome 17 open reading frame 64, hypothetical protein LOC124773 |
| Gene, Accession # | C17ORF64, Gene ID: 124773 |
| Catalog # | NBP1-70442 |
| Price | |
| Order / More Info | C17orf64 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |