| Edit |   |
| Antigenic Specificity | C17orf78 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The C17orf78 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C17orf78. This antibody reacts with human. The C17orf78 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to C17ORF78 The peptide sequence was selected from the middle region of C17ORF78. Peptide sequence LGARKLCQCQWLWRWQKKGGQPPGTAESKPDSQPQKVGQDAANSSNPKKA. |
| Other Names | chromosome 17 open reading frame 78, FLJ39647, hypothetical protein LOC284099, MGC34759 |
| Gene, Accession # | C17ORF78, Gene ID: 284099, Accession: Q8N4C9, SwissProt: Q8N4C9 |
| Catalog # | NBP1-60078-20ul |
| Price | |
| Order / More Info | C17orf78 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |