| Edit |   |
|---|
| Antigenic Specificity | C17orf82 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The C17orf82 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C17orf82. This antibody reacts with human. The C17orf82 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C17ORF82 The peptide sequence was selected from the N terminal of C17ORF82. Peptide sequence MGRPLEGQPLRALDLYPEPAFLRSGKDPKSSPASSPSFAVLGPEVRSTGG. |
|---|
| Other Names | chromosome 17 open reading frame 82, putative uncharacterized protein C17orf82 |
|---|
| Gene, Accession # | C17ORF82, Gene ID: 388407, Accession: Q86X59, SwissProt: Q86X59 |
|---|
| Catalog # | NBP1-56810 |
|---|
| Price | |
|---|
| Order / More Info | C17orf82 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|