| Edit |   |
| Antigenic Specificity | C18orf25 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The C18orf25 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C18orf25. This antibody reacts with human. The C18orf25 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QDTGATWRTSGLLEELNAEAGHLDPGFLASDKTSGNAPLNEEINIASSDSEVEIVGVQEHARCVHPR |
| Other Names | ARKadia-like 1, ARKL1, chromosome 18 open reading frame 25, hypothetical protein LOC147339, MGC12909, MGC87799 |
| Gene, Accession # | C18orf25, Gene ID: 147339 |
| Catalog # | NBP2-68825 |
| Price | |
| Order / More Info | C18orf25 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |