| Edit |   |
|---|
| Antigenic Specificity | C18orf25 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The C18orf25 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C18orf25. This antibody reacts with human. The C18orf25 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C18orf25 (chromosome 18 open reading frame 25) The peptide sequence was selected from the N terminal of C18orf25)(50ug). Peptide sequence MKMEEAVGKVEELIESEAPPKASEQETAKEEDGSVELESQVQKDGVADST. |
|---|
| Other Names | ARKadia-like 1, ARKL1, chromosome 18 open reading frame 25, hypothetical protein LOC147339, MGC12909, MGC87799 |
|---|
| Gene, Accession # | C18ORF25, Gene ID: 147339 |
|---|
| Catalog # | NBP1-57734-20ul |
|---|
| Price | |
|---|
| Order / More Info | C18orf25 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|