| Edit |   |
|---|
| Antigenic Specificity | C18orf32 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The C18orf32 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C18orf32. This antibody reacts with human. The C18orf32 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human C18orf32 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDK |
|---|
| Other Names | chromosome 18 open reading frame 32, FLJ23458, hypothetical protein LOC497661, Putative NF-kappa-B-activating protein 200, putative NFkB activating protein |
|---|
| Gene, Accession # | C18ORF32, Gene ID: 497661 |
|---|
| Catalog # | NBP1-83585 |
|---|
| Price | |
|---|
| Order / More Info | C18orf32 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|