| Edit |   |
| Antigenic Specificity | C18orf32 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The C18orf32 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C18orf32. This antibody reacts with human. The C18orf32 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to C18ORF32 The peptide sequence was selected from the middle region of C18ORF32. Peptide sequence PLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDKKK. |
| Other Names | chromosome 18 open reading frame 32, FLJ23458, hypothetical protein LOC497661, Putative NF-kappa-B-activating protein 200, putative NFkB activating protein |
| Gene, Accession # | C18ORF32, Gene ID: 497661, Accession: Q8TCD1, SwissProt: Q8TCD1 |
| Catalog # | NBP1-56827-20ul |
| Price | |
| Order / More Info | C18orf32 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |