| Edit |   |
|---|
| Antigenic Specificity | C19orf18 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The C19orf18 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C19orf18. This antibody reacts with human. The C19orf18 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C19orf18 (chromosome 19 open reading frame 18) The peptide sequence was selected from the N terminal of C19orf18. Peptide sequence NITGLPGSKRSQPPRNITKEPKVFFHKTQLPGIQGAASRSTAASPTNPMK. |
|---|
| Other Names | chromosome 19 open reading frame 18, hypothetical protein LOC147685, MGC41906 |
|---|
| Gene, Accession # | C19ORF18, Gene ID: 147685, Accession: Q8NEA5, SwissProt: Q8NEA5 |
|---|
| Catalog # | NBP1-70444 |
|---|
| Price | |
|---|
| Order / More Info | C19orf18 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|