| Edit |   |
|---|
| Antigenic Specificity | C19orf24 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The C19orf24 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C19orf24. This antibody reacts with human. The C19orf24 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C19ORF24 The peptide sequence was selected from the N terminal of C19ORF24. Peptide sequence MREGQEMGPTPVPSNPLLHRSFPCWPRGWSHPVPTRELLLEPAQPADLLP. |
|---|
| Other Names | C19orf24 chromosome 19 open reading frame 24, chromosome 19 open reading frame 24, FLJ20640, hypothetical protein LOC55009 |
|---|
| Gene, Accession # | C19ORF24, Gene ID: 55009, Accession: Q9BVV8, SwissProt: Q9BVV8 |
|---|
| Catalog # | NBP1-57556-20ul |
|---|
| Price | |
|---|
| Order / More Info | C19orf24 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|