| Edit |   |
| Antigenic Specificity | C19orf24 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The C19orf24 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C19orf24. This antibody reacts with human. The C19orf24 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to C19ORF24 The peptide sequence was selected from the N terminal of C19ORF24. Peptide sequence MREGQEMGPTPVPSNPLLHRSFPCWPRGWSHPVPTRELLLEPAQPADLLP. |
| Other Names | C19orf24 chromosome 19 open reading frame 24, chromosome 19 open reading frame 24, FLJ20640, hypothetical protein LOC55009 |
| Gene, Accession # | C19ORF24, Gene ID: 55009, Accession: Q9BVV8, SwissProt: Q9BVV8 |
| Catalog # | NBP1-57556 |
| Price | |
| Order / More Info | C19orf24 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |