| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PI 3-Kinase p55 gamma |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PI 3-Kinase p55 gamma Antibody from Novus Biologicals is a rabbit polyclonal antibody to PI 3-Kinase p55 gamma. This antibody reacts with human. The PI 3-Kinase p55 gamma Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human PIK3R3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MYNTVWSMDRDDADWREVMMPYSTELIFYIEMD |
|---|
| Other Names | 100% homology to SWISS-PROT Q92569, DKFZp686P05226, FLJ41892, p55, Phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma, phosphoinositide-3-kinase, regulatory subunit 3 (gamma), phosphoinositide-3-kinase, regulatory subunit 3 (p55, gamma), phosphoinositide-3-kinase, regulatory subunit, polypeptide 3 (p55, gamma), PI3K regulatory subunit gamma, PI3-kinase subunit p55-gamma, regulatory subunit, polypeptide 3 (p55, gamma) |
|---|
| Gene, Accession # | PIK3R3, Gene ID: 8503 |
|---|
| Catalog # | NBP2-57974 |
|---|
| Price | |
|---|
| Order / More Info | PI 3-Kinase p55 gamma Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|