| 产品详情 |
| Edit |   |
| Antigenic Specificity | PIK3R4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PIK3R4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PIK3R4. This antibody reacts with human. The PIK3R4 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PIK3R4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QLLAYRNGHFFPEQVLNKIEDHSIRELVTQMIHREPDKRLEAEDYLKQQRGNAFPEIFYTFLQPYMAQFAKETFLSADERILVIRKDLG |
| Other Names | EC 2.7.11.1, MGC102700, p150, phosphatidylinositol 3-kinase-associated p150, Phosphoinositide 3-kinase adaptor protein, phosphoinositide 3-kinase regulatory subunit 4, phosphoinositide-3-kinase, regulatory subunit 4, phosphoinositide-3-kinase, regulatory subunit 4, p150, PI3-kinase p150 subunit, PI3-kinase regulatory subunit 4, VPS 15, VPS15 |
| Gene, Accession # | PIK3R4, Gene ID: 30849, Accession: Q99570, SwissProt: Q99570 |
| Catalog # | NBP2-38276 |
| Price | |
| Order / More Info | PIK3R4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|