| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PILR-beta |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PILR-beta Antibody from Novus Biologicals is a rabbit polyclonal antibody to PILR-beta. This antibody reacts with human. The PILR-beta Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PILRB(paired immunoglobin-like type 2 receptor beta) The peptide sequence was selected form the middle region of PILRB. Peptide sequence KLTITQAVTTTTTWRPSSTTTIAGLRVTESKGHSESWHLSLDTAIRVALA. |
|---|
| Other Names | activating receptor PILRbeta, Activating receptor PILR-beta, Cell surface receptor FDFACT, cell surface receptor FDFACT1, cell surface receptor FDFACT2, FDFACT, FDFACT1, FDFACT2, paired immunoglobin-like receptor beta, paired immunoglobin-like type 2 receptor beta, paired immunoglobulin-like receptor beta, paired immunoglobulin-like type 2 receptor beta |
|---|
| Gene, Accession # | PILRB, Gene ID: 29990, Accession: Q9UKJ0, SwissProt: Q9UKJ0 |
|---|
| Catalog # | NBP1-62359 |
|---|
| Price | |
|---|
| Order / More Info | PILR-beta Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|