| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CT83 |
|---|
| Clone | CL4762 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CT83 Antibody (CL4762) from Novus Biologicals is a mouse monoclonal antibody to CT83. This antibody reacts with human. The CT83 Antibody (CL4762) has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CXorf61 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST |
|---|
| Other Names | chromosome X open reading frame 61, CT83, CT83Cancer/testis antigen 83, CXorf61, FLJ20611, FLJ22913, kita-kyushu lung cancer antigen 1, KKLC1, KK-LC-1, KK-LC-1KKLC1, RP3-452H17.2 |
|---|
| Gene, Accession # | CXORF61, Gene ID: 203413 |
|---|
| Catalog # | NBP2-59062 |
|---|
| Price | |
|---|
| Order / More Info | CT83 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|