| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CTAG2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 25ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CTAG2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CTAG2. This antibody reacts with human. The CTAG2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPL |
|---|
| Other Names | Autoimmunogenic cancer/testis antigen NY-ESO-2, CAMEL, cancer/testis antigen 2, Cancer/testis antigen 6.2, cancer/testis antigen family 6, member 2a, cancer/testis antigen family 6, member 2b, CT6.2a, CT6.2b, CTL-recognized antigen on melanoma, ESO2CT2, L antigen family member 1, LAGE1, LAGE-1a, LAGE-1a protein, LAGE-1b, LAGE-1CT6.2, LAGE2B, MGC138724, MGC3803 |
|---|
| Gene, Accession # | CTAG2, Gene ID: 30848 |
|---|
| Catalog # | NBP2-49659-25ul |
|---|
| Price | |
|---|
| Order / More Info | CTAG2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|