| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PMEL17/SILV |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PMEL17/SILV Antibody from Novus Biologicals is a rabbit polyclonal antibody to PMEL17/SILV. This antibody reacts with human, mouse. The PMEL17/SILV Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to SILV(silver homolog (mouse)) The peptide sequence was selected from the N terminal of human PMEL (NP_008859). Peptide sequence HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY. |
|---|
| Other Names | D12S53EP1, gp100, ME20, ME20-M, melanocyte protein mel 17, Melanocyte protein Pmel 17, Melanocytes lineage-specific antigen GP100, Melanoma-associated ME20 antigen, melanosomal matrix protein17, PMEL17P100, premelanosome proteinME20M, SI, SIL, silver (mouse homolog) like, silver homolog (mouse), Silver locus protein homolog, silver, mouse, homolog of, SILVPmel17 |
|---|
| Gene, Accession # | PMEL, Gene ID: 6490, Accession: P40967, SwissProt: P40967 |
|---|
| Catalog # | NBP1-69571 |
|---|
| Price | |
|---|
| Order / More Info | PMEL17/SILV Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 16516837, 24572365, 26511633, 26530832, 30009831 |
|---|
| 产品资料 |
|
|