| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | WDR47 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The WDR47 Antibody from Novus Biologicals is a rabbit polyclonal antibody to WDR47. This antibody reacts with human. The WDR47 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human WDR47 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EHSVIKPPLGDSPGSLSRSKGEEDDKSKKQFVCINILEDTQAVRAVAFHPAGGLYAVGSNSKTLRVCAYPDVIDPSAHETPKQPVV |
|---|
| Other Names | 2-MEBCAD, 2-methylbutyryl-coenzyme A dehydrogenase, ACAD7,2-methylbutyryl-CoA dehydrogenase, acyl-CoA dehydrogenase, short/branched chain, acyl-Coenzyme A dehydrogenase, short/branched chain, EC 1.3.99,2-methyl branched chain acyl-CoA dehydrogenase, EC 1.3.99.-, SBCADshort/branched chain specific acyl-CoA dehydrogenase, mitochondrial |
|---|
| Gene, Accession # | WDR47, Gene ID: 22911 |
|---|
| Catalog # | NBP1-81464 |
|---|
| Price | |
|---|
| Order / More Info | WDR47 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|