| Edit |   |
|---|
| Antigenic Specificity | WDR53 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The WDR53 Antibody from Novus Biologicals is a rabbit polyclonal antibody to WDR53. This antibody reacts with human. The WDR53 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to WDR53(WD repeat domain 53) The peptide sequence was selected from the middle region of WDR53. Peptide sequence NLLASADDSGAIKILDLENKKVIRSLKRHSNICSSVAFRPQRPQSLVSCG. |
|---|
| Other Names | G-beta repeat-containing protein, MGC12928, MGC64882, WD repeat domain 53, WD repeat-containing protein 53 |
|---|
| Gene, Accession # | WDR53, Gene ID: 348793, Accession: Q7Z5U6, SwissProt: Q7Z5U6 |
|---|
| Catalog # | NBP1-56804 |
|---|
| Price | |
|---|
| Order / More Info | WDR53 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|