| Edit |   |
| Antigenic Specificity | WDR55 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The WDR55 Antibody from Novus Biologicals is a rabbit polyclonal antibody to WDR55. This antibody reacts with human. The WDR55 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to WDR55(WD repeat domain 55) The peptide sequence was selected from the middle region of WDR55. Peptide sequence AKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACG. |
| Other Names | FLJ20195, FLJ21702, WD repeat domain 55, WD repeat-containing protein 55 |
| Gene, Accession # | WDR55, Gene ID: 54853, Accession: Q9H6Y2, SwissProt: Q9H6Y2 |
| Catalog # | NBP1-56385-20ul |
| Price | |
| Order / More Info | WDR55 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |