| Edit |   |
|---|
| Antigenic Specificity | Argininosuccinate Synthase |
|---|
| Clone | 2D2 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA, Immunocytochemistry/Immunofluorescence. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Argininosuccinate Synthase Antibody (2D2) from Novus Biologicals is a mouse monoclonal antibody to Argininosuccinate Synthase. This antibody reacts with human. The Argininosuccinate Synthase Antibody (2D2) has been validated for the following applications: ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | ASS1 (NP_000041.2, 121 a.a. - 220 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KGNDQVRFELSCYSLAPQIKVIAPWRMPEFYNRFKGRNDLMEYAKQHGIPIPVTPKNPWSMDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKAPNTP |
|---|
| Other Names | argininosuccinate synthase, argininosuccinate synthase 1, argininosuccinate synthetase, argininosuccinate synthetase 1, ASSCTLN1, citrulline-aspartate ligase, Citrulline--aspartate ligase, EC 6.3.4.5 |
|---|
| Gene, Accession # | ASS1, Gene ID: 445, Accession: NP_000041, SwissProt: NP_000041 |
|---|
| Catalog # | H00000445-M02 |
|---|
| Price | |
|---|
| Order / More Info | Argininosuccinate Synthase Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|