| 产品详情 |
| Edit |   |
| Antigenic Specificity | PSMA4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PSMA4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PSMA4. This antibody reacts with human. The PSMA4 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PSMA4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQA |
| Other Names | HC9EC 3.4.25.1, HsT17706, Macropain subunit C9, MGC12467, MGC24813, Multicatalytic endopeptidase complex subunit C9, proteasome (prosome, macropain) subunit, alpha type, 4, Proteasome component C9, proteasome subunit alpha type-4, proteasome subunit HC9, Proteasome subunit L, PSC9MGC111191 |
| Gene, Accession # | PSMA4, Gene ID: 5685, Accession: P25789, SwissProt: P25789 |
| Catalog # | NBP2-38754 |
| Price | |
| Order / More Info | PSMA4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|