| 产品详情 |
| Edit |   |
| Antigenic Specificity | SLC39A8/ZIP8 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SLC39A8/ZIP8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC39A8/ZIP8. This antibody reacts with human. The SLC39A8/ZIP8 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SLC39A8/ZIP8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LKTYGQNGHTHFGNDNFGPQEKTHQPKALPAINGVTCYANPAVTEANGHIHFDNVSVVSLQDGKKEPSSCTCL |
| Other Names | BCG induced integral membrane protein BIGM103, BIGM103BCG-induced integral membrane protein in monocyte clone 103 protein, LIV-1 subfamily of ZIP zinc transporter 6, LZT-Hs6, solute carrier family 39 (metal ion transporter), member 8, solute carrier family 39 (zinc transporter), member 8, Solute carrier family 39 member 8, zinc transporter ZIP8, ZIP8, ZIP-8, Zrt- and Irt-like protein 8 |
| Gene, Accession # | SLC39A8, Gene ID: 64116, Accession: Q9C0K1, SwissProt: Q9C0K1 |
| Catalog # | NBP2-34058 |
| Price | |
| Order / More Info | SLC39A8/ZIP8 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|