| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC39A8/ZIP8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC39A8/ZIP8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC39A8/ZIP8. This antibody reacts with human, rat. The SLC39A8/ZIP8 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to SLC39A8(solute carrier family 39 (zinc transporter), member 8) The peptide sequence was selected from the N terminal of SLC39A8. Peptide sequence QLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIINLASLLGLILTPLIKKS. |
|---|
| Other Names | BCG induced integral membrane protein BIGM103, BIGM103BCG-induced integral membrane protein in monocyte clone 103 protein, LIV-1 subfamily of ZIP zinc transporter 6, LZT-Hs6, solute carrier family 39 (metal ion transporter), member 8, solute carrier family 39 (zinc transporter), member 8, Solute carrier family 39 member 8, zinc transporter ZIP8, ZIP8, ZIP-8, Zrt- and Irt-like protein 8 |
|---|
| Gene, Accession # | SLC39A8, Gene ID: 64116, Accession: Q9C0K1, SwissProt: Q9C0K1 |
|---|
| Catalog # | NBP1-59601 |
|---|
| Price | |
|---|
| Order / More Info | SLC39A8/ZIP8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|