| Edit |   |
| Antigenic Specificity | CLRN1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CLRN1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CLRN1. This antibody reacts with human. The CLRN1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to LOC646951(similar to hCG1786685) The peptide sequence was selected from the middle region of LOC646951. Peptide sequence SQETLHGVLTRSDVGYLQWGKDASEDDRLSQVGSMLKTPKLPIWLCNING. |
| Other Names | C3orf76, CLRN1, family with sequence similarity 188, member B2, Putative UPF0526 protein B |
| Gene, Accession # | FAM188B2, Gene ID: 646951 |
| Catalog # | NBP1-70501 |
| Price | |
| Order / More Info | CLRN1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |