| 产品详情 |
| Edit |   |
| Antigenic Specificity | IFN-alpha/beta R1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The IFN-alpha/beta R1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IFN-alpha/beta R1. This antibody reacts with human. The IFN-alpha/beta R1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human IFN-alpha/beta R1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESKTSEELQQDFV |
| Other Names | alpha-type antiviral protein, AVP, beta-type antiviral protein, CRF2-1, Cytokine receptor class-II member 1, Cytokine receptor family 2 member 1, human interferon-alpha receptor (HuIFN-alpha-Rec)10IFRC, IFN-alpha/beta receptor 1, IFN-alpha-REC, IFNAR, IFNBR, IFN-R-1, interferon (alpha, beta and omega) receptor 1, interferon alpha/beta receptor 1, interferon-alpha/beta receptor alpha chain, interferon-beta receptor 1, Type I interferon receptor 1 |
| Gene, Accession # | IFNAR1, Gene ID: 3454, Accession: P17181, SwissProt: P17181 |
| Catalog # | NBP2-38144 |
| Price | |
| Order / More Info | IFN-alpha/beta R1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|