| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | XCR1/CCXCR1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. IHC-P reported in scientific literature (PMID: 28454081). For IHC-Paraffin,HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The XCR1/CCXCR1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to XCR1/CCXCR1. This antibody reacts with human. The XCR1/CCXCR1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human XCR1/CCXCR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MESSGNPESTTFFYYDLQSQPCENQAWVFATLA |
|---|
| Other Names | CCXCR1XC chemokine receptor 1, chemokine (C motif) receptor 1, chemokine XC receptor 1, G protein-coupled receptor 5, GPR5chemokine (C motif) XC receptor 1, G-protein coupled receptor 5, Lymphotactin receptor |
|---|
| Gene, Accession # | XCR1, Gene ID: 2829, Accession: P25024, SwissProt: P25024 |
|---|
| Catalog # | NBP1-88143 |
|---|
| Price | |
|---|
| Order / More Info | XCR1/CCXCR1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 28454081 |
|---|
| 产品资料 |
|
|