| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CDP/CUTL1 |
|---|
| Clone | 2A10 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin. Antibody reactivity against recombinant protein for WB. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CDP/CUTL1 Antibody (2A10) from Novus Biologicals is a mouse monoclonal antibody to CDP/CUTL1. This antibody reacts with human, mouse. The CDP/CUTL1 Antibody (2A10) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | CUTL1 (NP_001904.2, 521 a.a. - 620 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELRYSSQYEERLDPFSSFSKRERQRKYLSLSPWDKATLSMGRLVLSNKMARTI |
|---|
| Other Names | CCAAT displacement protein, CDP/Cux, CDPCCAAT displacement protein, COY1, CUT, cut (Drosophila)-like 1 (CCAAT displacement protein), cut-like 1, CCAAT displacement protein (Drosophila), cut-like homeobox 1, FLJ31745, golgi integral membrane protein 6, GOLIM6, homeobox protein cut-like 1, Homeobox protein cux-1, Nbla10317, p100, p110, p200, p75, protein CASP, putative protein product of Nbla10317 |
|---|
| Gene, Accession # | CUX1, Gene ID: 1523, Accession: AAH25422, SwissProt: AAH25422 |
|---|
| Catalog # | H00001523-M01 |
|---|
| Price | |
|---|
| Order / More Info | CDP/CUTL1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 20624841, 26005811, 26918661 |
|---|
| 产品资料 |
|
|