| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MCT3/SLC16A8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MCT3/SLC16A8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MCT3/SLC16A8. This antibody reacts with human, mouse. The MCT3/SLC16A8 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to SLC16A8(solute carrier family 16, member 8 (monocarboxylic acid transporter 3)) The peptide sequence was selected from the middle region of SLC16A8. Peptide sequence RAFAVYAVTKFLMALGLFVPAILLVNYAKDAGVPDTD |
|---|
| Other Names | MCT3MCT 3, monocarboxylate transporter 3, REMP, solute carrier 16 (monocarboxylic acid transporters), member 8, Solute carrier family 16 member 8, solute carrier family 16, member 8 (monocarboxylic acid transporter 3) |
|---|
| Gene, Accession # | SLC16A8, Gene ID: 23539, Accession: O95907, SwissProt: O95907 |
|---|
| Catalog # | NBP1-59885 |
|---|
| Price | |
|---|
| Order / More Info | MCT3/SLC16A8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|