| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MCT8/SLC16A2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MCT8/SLC16A2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MCT8/SLC16A2. This antibody reacts with human, mouse. The MCT8/SLC16A2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse MCT8/SLC16A2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LMHQRMFKKEQRDSSKDKMLAPDPDPNGELLPGSPNPEEPI |
|---|
| Other Names | DXS128, DXS128E, MCT 7, MCT 8, solute carrier family 16, member 2 (monocarboxylic acid transporter 8), XPCT |
|---|
| Gene, Accession # | SLC16A2, Gene ID: 6567 |
|---|
| Catalog # | NBP2-57308 |
|---|
| Price | |
|---|
| Order / More Info | MCT8/SLC16A2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|