| Edit |   |
| Antigenic Specificity | EVI5L |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The EVI5L Antibody from Novus Biologicals is a rabbit polyclonal antibody to EVI5L. This antibody reacts with human. The EVI5L Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human EVI5L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PRKLVVGELQDELMSVRLREAQALAEGRELRQRVVELETQDHIHRNLLNRVEA |
| Other Names | ecotropic viral integration site 5-like, Ecotropic viral integration site 5-like protein, EVI5-like protein |
| Gene, Accession # | EVI5L, Gene ID: 115704 |
| Catalog # | NBP2-54925 |
| Price | |
| Order / More Info | EVI5L Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |