| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SHC4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SHC4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SHC4. This antibody reacts with human. The SHC4 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human SHC4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SQESPTPLCTLIPRMASMKLANPATLLSLKNFCLGTKEVPRLKLQESRDPGSSGPSS |
|---|
| Other Names | hShcD, MGC34023, Rai-like protein, RaLPSH2 domain protein C4, SHC (Src homology 2 domain containing) family, member 4, SHCD, SHC-transforming protein 4, SHC-transforming protein D, Src homology 2 domain-containing-transforming protein C4 |
|---|
| Gene, Accession # | SHC4, Gene ID: 399694 |
|---|
| Catalog # | NBP2-56379 |
|---|
| Price | |
|---|
| Order / More Info | SHC4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|