| Edit |   |
|---|
| Antigenic Specificity | TMEM106B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMEM106B Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM106B. This antibody reacts with mouse. The TMEM106B Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The specific Immunogen is proprietary information. Peptide sequence AEEMSYMYDFCTLLSIKVHNIVLMMQVTVTTAYFGHSEQISQERYQYVDC. |
|---|
| Other Names | transmembrane protein 106B |
|---|
| Gene, Accession # | TMEM106B, Gene ID: 54664, Accession: NP_082268 |
|---|
| Catalog # | NBP1-91311-20ul |
|---|
| Price | |
|---|
| Order / More Info | TMEM106B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 29203673 |
|---|