| Edit |   |
| Antigenic Specificity | TMEM126B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TMEM126B Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM126B. This antibody reacts with human. The TMEM126B Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to TMEM126B(transmembrane protein 126B) The peptide sequence was selected from the N terminal of TMEM126B. Peptide sequence AASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQNIYQMATFGTT. |
| Other Names | HT007, MGC111203, transmembrane protein 126B |
| Gene, Accession # | TMEM126B, Gene ID: 55863, Accession: Q8IUX1, SwissProt: Q8IUX1 |
| Catalog # | NBP1-59768-20ul |
| Price | |
| Order / More Info | TMEM126B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |