| Edit |   |
|---|
| Antigenic Specificity | TMEM126B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMEM126B Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM126B. This antibody reacts with human. The TMEM126B Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TMEM126B(transmembrane protein 126B) The peptide sequence was selected from the N terminal of TMEM126B. Peptide sequence AASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQNIYQMATFGTT. |
|---|
| Other Names | HT007, MGC111203, transmembrane protein 126B |
|---|
| Gene, Accession # | TMEM126B, Gene ID: 55863, Accession: Q8IUX1, SwissProt: Q8IUX1 |
|---|
| Catalog # | NBP1-59768 |
|---|
| Price | |
|---|
| Order / More Info | TMEM126B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|