| Edit |   |
| Antigenic Specificity | Recoverin |
| Clone | 1D3 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG1 kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA. Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Recoverin Antibody (1D3) from Novus Biologicals is a mouse monoclonal antibody to Recoverin. This antibody reacts with human. The Recoverin Antibody (1D3) has been validated for the following applications: Western Blot, ELISA. |
| Immunogen | RCV1 (NP_002894.1, 101 a.a. - 199 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKN |
| Other Names | cancer associated retinopathy antigen, Protein CAR, RCV1Cancer-associated retinopathy protein, recoverin |
| Gene, Accession # | RCVRN, Gene ID: 5957, Accession: NP_002894, SwissProt: NP_002894 |
| Catalog # | H00005957-M03 |
| Price | |
| Order / More Info | Recoverin Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |