| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PCPE-1/PCOLCE |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 50 ul |
|---|
| Concentration | lyophilized |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PCPE-1/PCOLCE Antibody from Novus Biologicals is a rabbit polyclonal antibody to PCPE-1/PCOLCE. This antibody reacts with human, mouse. The PCPE-1/PCOLCE Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PCOLCE(procollagen C-endopeptidase enhancer) The peptide sequence was selected from the middle region of PCOLCE (NP_002584). Peptide sequence LLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKS. |
|---|
| Other Names | PCPE, PCPE-1, PCPE1Type I procollagen COOH-terminal proteinase enhancer, procollagen C-endopeptidase enhancer, procollagen C-endopeptidase enhancer 1, Procollagen COOH-terminal proteinase enhancer 1, Procollagen C-proteinase enhancer 1, procollagen, type 1, COOH-terminal proteinase enhancer, Type 1 procollagen C-proteinase enhancer protein |
|---|
| Gene, Accession # | PCOLCE, Gene ID: 5118, Accession: Q15113, SwissProt: Q15113 |
|---|
| Catalog # | NBP1-58045 |
|---|
| Price | |
|---|
| Order / More Info | PCPE-1/PCOLCE Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25947382 |
|---|
| 产品资料 |
|
|