| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PCPTP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PCPTP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PCPTP1. This antibody reacts with human. The PCPTP1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human PCPTP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLNVVVDPQGRGAPEIKATTATSVCPSPFK |
|---|
| Other Names | Ch-1 PTPase, ch-1PTPase, DKFZp781C1038, EC 3.1.3.48, ECPTP, EC-PTP, FLJ34328, MGC131968, MGC148170, NC-PTPCOM1, PCPTP1, protein tyrosine phosphatase Cr1PTPase, protein tyrosine phosphatase, receptor type, R, protein-tyrosine phosphatase NC-PTPCOM1, Protein-tyrosine phosphatase PCPTP1, PTPBR7, PTPRQ, PTP-SL, receptor-type tyrosine-protein phosphatase R, R-PTP-R |
|---|
| Gene, Accession # | PTPRR, Gene ID: 5801 |
|---|
| Catalog # | NBP2-58834 |
|---|
| Price | |
|---|
| Order / More Info | PCPTP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|