| Edit |   |
|---|
| Antigenic Specificity | Matrilin-4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Matrilin-4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Matrilin-4. This antibody reacts with human. The Matrilin-4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is MATN4 - N-terminal region. Peptide sequence LRGLNVGPNATRVGVIQYSSQVQSVFPLRAFSRREDMERAIRDLVPLAQG. |
|---|
| Other Names | FLJ14417, matrilin 4, matrilin-4 |
|---|
| Gene, Accession # | MATN4, Gene ID: 8785, Accession: NP_085095, SwissProt: NP_085095 |
|---|
| Catalog # | NBP1-98551 |
|---|
| Price | |
|---|
| Order / More Info | Matrilin-4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|