| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CDC26 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CDC26 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CDC26. This antibody reacts with human. The CDC26 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CDC26 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSL |
|---|
| Other Names | ANAPC12chromosome 9 open reading frame 17, Anaphase-promoting complex subunit 12, anaphase-promoting complex subunit CDC26, APC12anaphase promoting complex subunit 12, C9orf17, CDC26 subunit of anaphase promoting complex, cell division cycle 26, cell division cycle 26 homolog (S. cerevisiae), Cell division cycle protein 26 homolog |
|---|
| Gene, Accession # | CDC26, Gene ID: 246184 |
|---|
| Catalog # | NBP1-91771 |
|---|
| Price | |
|---|
| Order / More Info | CDC26 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|