| Edit |   |
|---|
| Antigenic Specificity | SRP54 |
|---|
| Clone | 2G7 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SRP54 Antibody (2G7) from Novus Biologicals is a mouse monoclonal antibody to SRP54. This antibody reacts with human. The SRP54 Antibody (2G7) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | SRP54 (NP_003127.1, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGK |
|---|
| Other Names | signal recognition particle 54 kDa protein, signal recognition particle 54kD, signal recognition particle 54kDa |
|---|
| Gene, Accession # | SRP54, Gene ID: 6729, Accession: NP_003127, SwissProt: NP_003127 |
|---|
| Catalog # | H00006729-M01 |
|---|
| Price | |
|---|
| Order / More Info | SRP54 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|