| Edit |   |
| Antigenic Specificity | SRP54 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SRP54 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SRP54. This antibody reacts with human. The SRP54 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to SRP54(signal recognition particle 54kDa) The peptide sequence was selected from the middle region of SRP54. Peptide sequence ENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEA. |
| Other Names | signal recognition particle 54 kDa protein, signal recognition particle 54kD, signal recognition particle 54kDa |
| Gene, Accession # | SRP54, Gene ID: 6729, Accession: P61011, SwissProt: P61011 |
| Catalog # | NBP1-57414 |
| Price | |
| Order / More Info | SRP54 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |